Encyclopedia: GLU...
Encyclopedia : G : GL : GLU (280 articles)
G. Lucas Crane Vs. Non-Horse
G. Lucas Crane Vs. Non-Horse is the solo act of Gabriel Lucas Crane. His style is highly innovative in its use of two cassette tape decks to mix music similar to a DJ of the vinyl record. He also makes use of many children's toys modified by the process of circuit bending. Lucas performs with other ..
GLU
GLU is the OpenGL Utility Library. It consists of a number of functions that use the base OpenGL library to provide higher-level drawing routines from the more primitive routines that OpenGL provides. It is usually distributed with the base OpenGL package. Among these features are mapping betwe..
Glu
If you are looking for the amino acid glu, please reference Glutamic acid If you are looking for the OpenGL Utility Library glu, please reference GLU Glu Mobile (formerly Sorrent, Inc. and Macrospace Ltd.) is a leading developer and global publisher of mobile entertainment. With more than 100 en..
GLUA
[GLUA] is the [University of Aveiro]'s linux group. [GLUA] is integrated in [Dep. of Electronics and Telecommunications] and has the objective of promoting open source software, namely solutions based on GNU/Linux. Activities Maintains a schedule to suppor..
Gluaiseacht
Gluaiseacht for Global Justice is an Irish environment, peace and social justice group. Gluaiseacht means movement in the Irish lanuage. (ag gluaiseacht = in movement). The group believes in non-violent resistance to the current form of capitalist globalisation. External link [Gluaiseacht for..
Glubbdubdrib
Glubbdubdrib was an island of sorcerors and magicians, one of the imaginary countries visited by Lemuel Gulliver in the satire Gulliver's Travels by English author Jonathan Swift. On visiting Glubbdubdrib, Gulliver had the occasion, thanks to the power of their necromancers, to speak with Brutus o..
Glucagon
Glucagon ball and stick model Glucagon Glucagon is a 29-amino acid polypeptide acting as an important hormone in carbohydrate metabolism. The polypeptide has a molecular weight of 3485 daltons and was discovered in 1923 by Kimball and Murlin. Its primary structure is: NH2-His-Ser-Gln-G..
Glucagon-like peptide-1
..
Glucagon-like peptide-2
Glucagon-like peptide-2 (GLP-2) is a 33 amino acid peptide with the sequence HADGSFSDEMNTILDNLAARDFINWLIQTKITD in humans. GLP-2 is created by specific post-translational proteolytic cleavage of proglucagon in a process that also liberates the related glucagon-like peptide-1 (GLP-1). GLP-2 is produce..
Glucagonoma
A glucagonoma is a rare tumor of the alpha cells of the pancreas that results in up to a 1000-fold overproduction of the hormone glucagon. Alpha cell tumors are commonly associated with glucagonoma syndrome, though similar symptoms are present in cases of pseudoglucagonoma syndrome in the absence o..
Glucagon receptor
The glucagon receptor is a 62 kDa peptide that is activated by glucagon and is a member if the g-protein coupled family of receptors. Stimulation of the receptor results in activation of adenylate cyclase and increased levels of intracellular cAMP. Glucagon receptors are mainly expressed in liver i..
Glucan
A glucan molecule is a polysaccharide of D-glucose monomers linked by glycosidic bonds. The following are glucans: cellulosepullulanlaminarinstarchglycogendextranlichenin Medical applications Glucans form part of the cell wall of certain medically important fungi, including Candida and Aspergillus s..
Glucocerebrosidase
Glucocerebrosidase (also called glucosylceramidase or D-glucosyl-N-acylsphingosine glucohydrolase) is an enzyme (EC [3.2.1.45]) that is needed to break down the chemical glucocerebroside by hydrolysis. It is localized in the lysosome and has a molecular weight of 59700 Da. It is the enzy..
Glucocerebroside
Glucocerebroside (also called glucosylceramide) is any of the cerebrosides in which the monosaccharide head group is glucose. They occur mostly in nonneuronal tissue and accumulate abnormally in Gaucher disease, where glucocerebrosidase is absent or nonfunctional. ..
Glucocorticoid
Glucocorticoids are a class of steroid hormones characterised by an ability to bind with the cortisol receptor and trigger similar effects. Glucocorticoids are distinguished from mineralocorticoids and sex steroids by the specific receptors, target cells, and effects. Technically, the term corticos..
Glucocorticoid deficiency 1
Glucocorticoid deficiency 1 is an adrenocortical failure characterized by low levels of plasma cortisol despite high levels of plasma ACTH. External links OMIM [202200] ..
Glucocorticoid receptor
..
Glucokinase
..
Glucokinase regulatory protein
..
Glucomannan
Glucomannan is a water-soluble dietary fiber composing 40% by dry weight of the roots or corm of the konjac plant. Glucomannan has been marketed as a treatment for constipation, obesity, high cholesterol, and Type 2 diabetes. Contents 1 Health benefits1.1 Constipation1.2 Obesity1...
Glucometer
Glucometer is a brand of glucose meter. The trademark is owned by Bayer. [link] The word "Glucometer" is often used as a genericized trademark for any glucose meter. [link] External links [Glucometer website][Bayer website] ..
Gluconeogenesis
Diagram of Gluconeogenesis Gluconeogenesis is the generation of glucose from other organic molecules like pyruvate, lactate, glycerol, and amino acids. The vast majority of gluconeogenesis takes place in the liver and, to a smaller extent, in the kidney. This process occurs during periods o..
Gluconic acid
Gluconic acid is the carboxylic acid formed by the oxidation of the first carbon of glucose and has the chemical formula C6H12O7. When dissolved in water, it forms the gluconate ion C6H11O7−; the salts of gluconic acid are also known as gluconates. Contents 1 Chemical structure2 U..
Glucono delta-lactone
Glucono delta-lactone Chemical name D-Glucono-1,5-lactone Chemical formula C6H10O6 Molecular mass 178.14 g/mol CAS number [90-80-2] Density x.xxx g/cm3 Melting point xx.x °C Boiling point xx.x °C SMILES xxx [Chemical infoboxDisclaimer and references..
Glucosamine
Chemical structure of α-D-glucosamine Glucosamine (C6H14NO5) is an amino sugar that is an important precursor in the biochemical synthesis of glycosylated proteins and lipids. Glucosamine is commonly used as a treatment for osteoarthritis, although its acceptance as a medical therapy varies. ..
Glucose
Glucose Chemical name 6-(hydroxymethyl)oxane-2,3,4,5-tetrol Synonym for D-glucose dextrose Varieties of D-glucose α-D-glucose; β-D-glucose Abbreviations Glc Chemical formula C6H12O6 Molecular mass 180.16 g mol−1 Melting point α-D-glucose: 146°Cβ-D-glucose: 150°C ..
Glucose-1-phosphate
Glucose 1-phosphate is a glucose molecule with a phosphate group on the 1-carbon. It is the direct product of the reaction in which glycogen phosphorylase cleaves off a molecule of glucose from a greater glycogen structure. It cannot travel down many metabolic pathways and must be interconverted by..
Glucose-6-phosphate
Glucose-6-phosphate Chemical name D-glucose-6-phosphate General Chemical formula C6H13O9P Molecular weight 260.14 g/mol Appearance ? CAS number 56-73-5 MSDS Glucose-6-phosphate MSDS]] Other names D-glucose-6-Pglucose-6-PD-glucose-6-phosphate Physical properties Density a..
Glucose-6-phosphate dehydrogenase deficiency
Glucose-6-phosphate dehydrogenase (G6PD) deficiency is an X-linked recessive hereditary disease featuring nonimmune hemolytic anemia in response to a number of causes. The classic allergy to consumption of broad beans has led to the commonly used term favism, derived from the Italian name of the br..
Glucose-dependent insulinotropic peptide
..
Glucosepane
Glucosepane is an protein cross-linking product that is the most common protein cross-link found in senescent skin. Glucosepane forms from a glucose-lysine Amadori product reacting with an arginine molecule. Glucosepane occurs with about twice the frequency in diabetics as is found in non-diabetic..
Glucose 6-phosphatase
Glucose 6-phosphatase is an enzyme in the glycogenolysis pathway that removes the phosphate from glucose 6-phosphate. Also is the last step in gluconeogenesis where the goal is to increase free glucose in the blood due body being in catabolic state. The main purpose of glucose 6-phosphatase is to d..
Glucose catabolism
Glucose is the major food molecule for living cells. The breakdown of Glucose into energy in the form of molecules of ATP is therefore one of the most important biochemical pathways found in living organisms. Anaerobic respiration is the metabolic pathway where glucose is broken down in the absence..
Glucose isomerase
..
Glucose meter
Four generations of blood glucose meter, c. 1993-2005. Sample sizes vary from 30 to 0.3 μl. Test times vary from 5 seconds to 2 minutes (modern meters are typically below 15 seconds). A glucose meter (or glucometer) is a medical device for determining the approximate amount of glucose in ..
Glucose oxidase
The glucose oxidase enzyme (GOx) (EC [1.1.3.4]) binds to beta-D-glucose (an isomer of the six carbon sugar, glucose) and aids in breaking the sugar down into its metabolites. GOx is a dimeric protein which catalyzes the oxidation of beta-D-glucose into D-glucono-1,5-lactone which then hyd..
Glucose paradox
Glucose paradox is a theory formulated by biochemist Dr. J. D. McGarry and his research associates. It is a theory that demonstrates the importance of lactic acid in carbohydrate metabolism. After the digestion of carbohydrates and their entering into the circulatory system in the form of glucose (..
Glucose test
A glucose test is a type of blood test used to determine the amount of glucose in the blood. There are several different kinds of glucose tests: "Fasting blood sugar" (FBS) -- 12 hours after eatingpostprandial (PC) -- 2 hours after eatingglucose tolerance test -- continuous testing A range of 4..
Glucose tolerance test
A glucose tolerance test in medical practice is the administration of glucose to determine how quickly it is cleared from the blood. The test is usually used to test for diabetes, insulin resistance, and sometimes reactive hypoglycemia. The glucose is most often given orally so the common test is te..
Glucose transporter
Glucose transporters (GLUT or SLC2A family) are a family of membrane proteins found in most mammalian cells. Contents 1 Function2 Structure3 Types3.1 Class I3.2 Classes II/III4 Synthesis of free glucose Function Glucose is an essential substrate for the metabolism o..
Glucose uptake
Glucose uptake is the process by which glucose is transported into cells through active transport. Though some glucose does enter cells through passive diffusion, the process is too slow to allow for adequate control of blood glucose levels and energy utilization. Glucose uptake is inititated by ins..
Glucosidases
..
Glucoside
A glucoside is a glycoside that is derived from glucose. Glucosides are common in plants, but rare in animals. Glucose is produced when a glucoside is hydrolysed by purely chemical means, or decomposed by fermentation or enzymes. The name was originally given to plant products of this nature, in wh..
Glucosinolate
The glucosinolates are a class of organic compounds that contain sulfur, nitrogen and a group derived from glucose. They occur as secondary metabolites of many plants of the order Capparales (especially in the family Brassicaceae). Plants use substances derived from glucosinolates as natural pesti..
Glucosyltransferases
Glucosyltransferases are a type of Glycosyltransferase which enable the transfer of glucose. Examples include: glycogen synthaseglycogen phosphorylase They are categorized under EC number 2.4.1. External links MeSH [Glucosyltransferases] ..
Glucuronic acid
Glucuronic acid (from Greek γλυκερός - "sweet") is a carboxylic acid that has the structure of a glucose molecule that has had its sixth carbon atom (of six total) oxidized. Its formula is C6H10O7. The salts of glucuronic acid are known as glucuronates; the anion C6H9O7− is the gl..
Glucuronidase
Glucuronidase is a lysosomal glycosidase, a type of enzyme that removes carbohydrate groups from proteins. Glucuronidase exhibits both endo-glycosidase and exo-glycosidase activities, meaning that it can cleave monosaccharides from the middle of a chain or from the end. Glycosylation is an interes..
Glucuronidation
Glucuronidation is a major inactivating pathway for a huge variety of exogenous and endogenous molecules, including drugs, polluants, bilirubin, androgens, estrogens, mineralocorticoids, glucocorticoids, fatty acid derivatives, retinoids and bile acids. Contents 1 Acyl glucuronidation2&nbs..
Glucuronide
A glucuronide, also known as glucuronoside, is any substance produced by linking glucuronic acid to another substance via a glycosidic bond. The glucuronides belong to the glycosides. Toxic substances can be removed from the body in this manner - glucuronic acid forms a glycosidic bond with the tox..
Glucuronolactone
Glucuronolactone is a naturally occurring chemical compound produced by the metabolization of glucose in the human liver. It has received some notoriety due to rumors that it was a Vietnam War-era drug manufactured by the American government. The rumor goes on to say that it was banned due to seve..
Glucuronosyltransferase
..
Glue
Historically, glue only refers to protein colloids prepared from animal tissues. The meaning has been extended to any type of glue-like substances that are used to attach one material to another. See adhesive for general discussion of glue. There are many adhesive substances that are considered or..
Gluecifer
Gluecifer was a hard rock band based in Oslo, Norway. Formed in 1994, they produced several underground releases during their first years of existence and soon claimed, with typical arrogance, to be "kings of rock". In 1997, the album "Ridin' the Tiger" (released by legendary record label White Jaz..
Gluecode
Gluecode is an application server, based on Geronimo code from the Apache Software Foundation. The source code for Gluecode is maintained by Gluecode Software, Inc., which was acquired by IBM in May, 2005. IBM has now renamed the product to WebSphere Application Server Community Edition. They plan t..
Glued laminated timber
Glued laminated timber, also called glue-laminated beams or Glulam, is a structural timber product composed of several layers of dimensioned lumber glued together. By laminating several smaller pieces of wood, a single large, strong, structural member can be manufactured from smaller timber. These s..
Gluegen
GlueGen is a Java tool which automatically generates the Java and JNI code necessary to call C libraries from Java code. It reads as input ANSI C header files and separate configuration files which provide control over the glue code generation. As JNI can be not easy to implement, Gluegen simplifi..
Gluemeat
Gluemeat is a webcomic written and drawn by Case Yorke. It began on November 19, 2001 with ["Success"]. Gluemeat is a member of Alternative Brand Studios and it often employs the use of non-sequitur humor. Its primary characters are Blue Guy and Orange Guy, although it has spawned several..
GlueX
GlueX is an experiment which aims to understand the nature of confinement in quantum chromodynamics by mapping the spectrum of mesons generated by the excitation of the gluonic field binding the quarks. See [GlueX.org] ..
Gluey Porch Treatments
Gluey Porch Treatments is an album by The Melvins, which was released in 1987 through Alchemy Records. The original release was vinyl only. This album has been rereleased on tape with the Six Songs EP through Boner Records and appears as bonus material on the CD version of Ozma. Tracks 18-29 can on..
Glue (novel)
Glue is a novel by Scottish writer Irvine Welsh. Glue tells the stories of four Scottish boys over a few decades, through the use of different perspectives and different voices. Glue addresses sex, drugs, violence, and other social problems in Scotland through the lives of four boys. The title refe..
Glue code
In programming, glue code is code that does not compute anything functional towards meeting the program's requirements, but instead serves solely to "glue together" different parts of code that would otherwise not be compatible. Glue code often appears in code written to let existing libraries or pr..
Glue Gun (band)
Glue Gun (formerly known as Glü Gun) is an American punk rock band from Los Angeles, California. Biography The band started in 1991 under the name Glü Gun after singer Bob Oedy's previous band project The Grim dissolved in 1989. Other members were Jeff Roberts (guitars), Chris Long (guitars), P..
Glue language
A glue language is a programming language (usually a scripting language) used for connecting software components together. Examples of glue languages: Shell scriptsPythonRubyLuaPerlPHP[GLUE language] See also: ..
Glue logic
In electronics, glue logic refers to the custom electronic circuitry needed to ensure compatibility for interfacing off-the-shelf semiconductor components. This is often achieved with the use af a CPLD or FPGA. ..
Glue stick
Glue sticks are solid adhesives in twist or push-up tubes. The user can apply glue by holding the open tube, thus keeping their fingers clean. Glue sticks were reportedly first made popular by UHU, which produced the "Glue Stic" brand. There are now permanent, washable, acid-free and dyed varie..
Glufosinate
Glufosinate or its ammonium salt is an active ingredient in several nonselective systemic herbicides - Basta, Rely, Finale, Challenge and Liberty. Glufosinate is a natural compound which was first isolated from two species of Streptomyces bacteria. It interferes with the biosynthetic pathway of th..
Gluggy
Wikipedia does not currently have an encyclopedia article for . You may like to search Wiktionary for "[[Wiktionary:Special:Search/|]]" instead. To begin an article here, feel free to [http://encycl.opentopia.com/[not available] edit this page], but please do not create a mere..
Gluhareff Pressure Jet
[link] The Gluhareff Pressure Jet (or tip jet) is a type of jet engine that, like a Pulse jet, has no moving parts. It was invented by Eugene Gluhareff, a Russian engineer who envisaged it as a power plant for personal helicopters and compact aircraft (such as Microlights). Contents 1..
GLUI
GLUI is a GLUT-based C++ user interface library which provides controls such as buttons, checkboxes, radio buttons, and spinners to OpenGL applications. It is window- and operating-system independent, relying on GLUT to handle all system-dependent issues, such as window and mouse management. It lac..
Gluing axiom
In mathematics, the gluing axiom is introduced to define what a sheaf F on a topological space X must satisfy, given that it is a presheaf, which is by definition a contravariant functor F: O(X) → C to a category C which initially one takes to be the category of sets. Here O(X) is the partia..
Gluino
A gluino is the hypothetical supersymmetric partner of the gluon. Gluinos are Majorana fermions and interact via the strong nuclear force as an octet of color. Gluinos have a lepton number 0, baryon number 0, and spin 1/2. Gluinos are dominantly pair produced at a hadron collider. Gluinos dec..
Glukkons
} with }.>}} This article is being considered for deletion in accordance with Wikipedia's [Deletion policydeletion policy][[Template:Afd|.]] Please share your thoughts on the matter at [Articles for deletion/this article's entry] on the Articles for deletion page. Feel free ..
Glulx
Glulx is a 32-bit portable virtual machine intended for writing and playing interactive fiction. It was designed by Andrew Plotkin to work around some perceived restrictions in the venerable Z-machine format. The Inform compiler can produce either Z-machine or Glulx programs. A Spanish interactive ..
Gluma
Gluma Desensitizer is the most widely used product in the United States for the treatment of dental sensitivity. Its formula of 5% glutaraldehyde and 35% HEMA (hydroxyethyl methacrylate) in water is used to help control both hypersensitive dentin and reduce the incidence of post-operative sensitivit..
Glumaceae
Glumaceae is a descriptive botanical name. It was used in the Bentham & Hooker system (volume of 1883) for the order including the grass family: order Glumaceae: family Eriocauleae: family Centrolepideae: family Restiaceae: family Cyperaceae: family Gramineae The APG II system places the plants inv..
Glumdalclitch
Glumdalclitch is the name of Gulliver's "nurse" in Book II of Jonathan Swift's Gulliver's Travels. In Book I, Gulliver travels to the land of Lilliput. Leaving there, he travels to the land of Brobdingnag. In Lilliput, Gulliver was a giant, and in Brobdingnag, he is a dwarf, with the proportions ..
Glume
A glume, in grasses (Poaceae) and sedges (Cyperaceae), is a basal, membranous, outer sterile husk or bract in grass flowers that do not stand directly at the flower base. The glume, alone or with others, encloses the spikelet. The spikelet is a flowering unit comprised of one or more florets enclose..
Glumiflorae
Glumiflorae is a descriptive botanical name. It was used in the Wettstein system for an order of flowering plants. The order consisted of one family only: order Glumiflorae: family Gramineae The APG II system, used here, assigns the grass family to the order Poales. Other names for the order includ..
Glunimore Island
Tiny, uninhabitated Glunimore Island lies along side Sanda and Sheep Island around 5 kilometres south east of the Kintyre peninsula, Scotland (Grid reference ). The island is just 0.2 kilometres long and rises to a height of 27m. There is a cave on the shoreline at the north. A drying reef surroun..
Gluon
In particle physics, gluons are vector gauge bosons that mediate strong color charge interactions of quarks in quantum chromodynamics (QCD). Unlike the neutral photon of quantum electrodynamics (QED), gluons themselves participate in strong interactions. The gluon has the ability to do this as it ca..
Gluon condensate
In Quantum chromodynamics (QCD), the gluon condensate is a non-perturbative property of the QCD vacuum which could be partly responsible for giving masses to certain hadrons. If the gluon field tensor is represented as Gμν, then the gluon condensate is the vacuum expectation value [\lang..
Glurch
Glurch is the nickname given to a polymer substance created in many middle school science courses. It consists of starch, glue and food coloring. It is used to show the process of polymerization. See also oobleck. ..
Glurge
Glurge is a neologism describing a certain kind of melodramatic, saccharine story. The defining characteristic of glurge is that, while its purpose is to make the reader happy, the feel-good aspect is so overdone that some readers are likely to be nauseated rather than inspired. It often has a relig..
Glurp
Glurp is an Austin, Texas based independent record label. The label released records by Grand Champeen, The Deathray Davies, Li'l Cap'n Travis and The Only Children. They also released the Elvis Costello tribute CD Almost You: The Songs of Elvis Costello. See also List of record labels ..
Glushko (crater)
Crater characteristics Coordinates ..
Gluster
Gluster is a GNU cluster distribution aimed at commoditizing Supercomputing and Superstorage. Core of the Gluster provides a platform for developing clustering applications tailored for a specific tasks such as HPC Clustering, Storage Clustering, Enterprise Provisioning, Database Clustering etc. I..
Glut
Look up [[wiktionary:|}}}]] in Wiktionary, the free dictionary. The word glut may refer to: Glut, a supposed German translation of Fornjót from Norse mythologyGLUT, short for 'OpenGL Utility Toolkit', a library of utilities for OpenGL computer programsGLUT, short for glucose transporter in bi..
GLUT1
..
GLUT2
..
Glutamatergic system
The glutamatergic neurotransmitter system plays a crucial role in memory formation and information processing. Glutamate is the most common excitatory neurotransmitter in the central nervous system. Disturbances in this system contribute to the manifestation of AD symptoms. ..
Glutamate decarboxylase
..
Glutamate dehydrogenase
Glutamate dehydrogenase is an enzyme, present in mitochondria of eukaryotes, as are some of the other enzymes required for urea synthesis, that converts glutamate to α-Ketoglutarate, and vice versa. Its cofactor for the glutamate to α-Ketoglutarate reaction, which produces ammonium as well..
Glutamate Dehydrogenase 1
Human GLUD1 contains 13 exons and is located on the 10th chromosome. There is evidence that GLUD1 has been retro-posed to the X chromosome, where it gave rise to the intronless GLUD2 through random mutations and natural selection. GLUD2 have adapted to the particular needs of the nervous system ..
Glutamate receptor
Glutamate is a neurotransmitter in nerve cells which binds to all glutamate receptors located on neuron membranes, and is an example of a transmembrane receptor. Glutamate is the most prominent neurotransmitter in the body, being present in over 50% of nervous tissue. The primary glutamate receptor ..
Glutamate transporter
Glutamate transporters exist in the membranes of neurons and glial cells to remove excess amounts of the amino acid neurotransmitters glutamate and aspartate from the synapse. Since these excitatory amino acids cannot diffuse across the blood brain barrier, they require active transport, which is a..
Glutamic acid
Glutamic acid (Glu), also referred to as glutamate (the anion), is one of the 20 proteinogenic amino acids. It is not among the essential amino acids. Contents 1 Structure2 Synthesis2.1 Natural3 Function3.1 In metabolism3.2 As a neurotransmitter3.2.1 GABA pre..
Glutamic acid (data page)
References a [CID 23327] from PubChem (D-glutamic acid)a [CID 33032] from PubChem (L-glutamic acid) Amino acids Alanine (dp) | Arginine (dp) | Asparagine (dp) | Aspartic acid (dp) | Cysteine (dp) | Glutamic acid (dp) | Glutamine (dp) | Glycine (dp) | Histidine..
Glutamine
Glutamine is one of the 20 amino acids encoded by the standard genetic code. Its side chain is an amide; it is formed by replacing a side-chain hydroxyl of glutamic acid with an amine functional group. Contents 1 Biochemistry1.1 Formation and Nomenclature2 Nutrition2.1 Usag..
Glutamine (data page)
References a [CID 738] from PubChem (Gln)a [CID 145815] from PubChem (D)a [CID 5961] from PubChem (L) ..
Glutamine oxoglutarate aminotransferase
Glutamine oxoglutarate aminotransferase is an enzyme ..
Glutamine synthetase
Evolution of the glutamine synthetase gene, one of the oldest existing and functioning genes. 1993 Apr 1; [More information in PubMed for 8096645] [Free text] Glutamine synthetase II in Rhizobium: reexamination of the proposed horizontal transfer of DNA from eukaryotes to prokar..
Glutaraldehyde
Properties General Name Glutaraldehyde Chemical formula C5H8O2 Molecular weight 100.117 amu Synonyms Glutaraldehyde; Pentanedial; Glutural; Aldesan; Aldesen; Alhydex; Cidex; Glutardialdehyde; Glutaric acid dialdehyde; Glutaric aldehyde; Glutaric dialdehyde; Hospex; Sonacide; 1,..
Glutaric acid
Glutaric acid Common name glutaric acid Systematic name pentanedioic acid Other names propane-1,3-dicarboxylic acid Chemical formula HOOC(CH2)3COOH Molecular mass 132.12 g/mol Melting point 95°C to 98°C Boiling point 200°C CAS number [328-42-7] EINE..
Glutaric acidemia type 1
Glutaric acidemia type 1 (or "Glutaric Aciduria", "GA1", or "GAT1") is an inherited disorder in which the body is unable to process the amino acid lysine, hydroxylysine and tryptophan properly. Excessive levels of these amino acids and their intermediate breakdown products can accumulate and cause..
Glutaric acidemia type 2
Glutaric acidemia type 2 is an genetic disorder that is characterised by defects in the body's ability to use proteins and fats for energy. Incompletely processed proteins and fats can build up, leading to a dangerous chemical imbalance called acidosis. Glutaric acidemia type 2 often appears in infa..
Glutaronitrile
Glutaronitrile Common name glutaronitrile Systematic name pentanedinitrile Other names dicyanopropane Chemical formula C5H6N2 Glutaronitrile, also pentanedinitrile, is a nitrile, with formula C3H6(CN)2. External links For a full list of external links to MSDSs, spectroscopic data,..
Glutathione
Skeletal formula of glutathione 3D model of glutathione Glutathione (GSH), whose IUPAC name is 2-amino-5--5-oxopentanoic acid, is γ-glutamylcysteinylglycine, a tripeptide. It contains an unusual peptide linkage between the amine group of cysteine and the carboxyl group of the gluta..
Glutathione peroxidase
Glutathione Peroxidase 1 ..
Glutathione reductase
..
Glutathione S-transferase
The Glutathione S-transferase (GST) family of enzymes comprises a long list of cytosolic, mitochondrial, and microsomal proteins which are capable of multiple reactions with a multitude of substrates, both endogenous and xenobiotic. Contents 1 Families of GST2 Structure of GSTs3 ..
Gluteal artery
Gluteal artery can refer to: Superior gluteal arteryInferior gluteal arteryThis is a [disambiguationdisambiguation] page: a list of articles associated with the same title. If an referred you to this page, you may wish to change the link to point directly to the intended article. ..
Gluteal cleft
The gluteal cleft is the groove or crack between the buttocks that runs from just below the sacrum to the perineum, so named because it forms the visible border between the external rounded protrusions of the gluteus maximus muscle. The gluteal cleft is the location of the anus. Slang terms Sl..
Gluteal muscles
The gluteal muscles are the three muscles that make up the human buttocks. The gluteal muscles are formed of the gluteus maximus, gluteus minimus and gluteus medius. Collectively the area of the gluteal muscles is often referred to as the bottom, butt or rear-end. Contents 1 The Gluteal ..
Gluteal nerve
Gluteal nerve can refer to: Superior gluteal nerveInferior gluteal nerveThis is a [disambiguationdisambiguation] page: a list of articles associated with the same title. If an referred you to this page, you may wish to change the link to point directly to the intended article. ..
Gluten
For the food product made from gluten see Wheat gluten (food). Wheat - a prime source of gluten Gluten is an amorphous ergastic protein found combined with starch in the endosperm of some cereals, notably wheat, rye, and barley. It constitutes about 80% of the proteins contained in wheat, and..
Gluten-free, casein-free diet
Many parents of children with autism have reported that a gluten-free casein-free diet helps their children. According to the theory, some children are unable to digest the protein in many cereals (gluten) or in milk (casein) completely. Contents 1 Theory2 Reported effects3 Practi..
Gluten-free diet
A gluten-free diet is a diet completely free of ingredients derived from gluten-containing cereals: wheat (including Kamut and spelt), barley, rye, and triticale. The suitability of oats in the gluten-free diet is still somewhat controversial; however the most recent findings indicate oats in themse..
Glutenin
Glutenin (or glutenine) is a protein best known for its role, along with in gliadin, in the creation of gluten with its disulfide inter- and intra-molecule links. It consists of 20% HMW (High-Molecular-Weight) subunits, which are relativy low in sulfur. The other 80% are LMW (Low-Molecular-Weight) ..
Gluten exorphine
This does not cite its [[Opentopia:Citing sources|references or sources]]. You can [[Opentopia:WikiProject Fact and Reference Check|help]] Wikipedia by introducing appropriate citations. The Gluten exorphines are a group of opioid peptides which are formed during digestion of the gluten protein. T..
Gluten free beer
Gluten free beer is beer made from ingredients without glycoproteins (gluten) that, for people with a variety of medical conditions, cause an autoimmune response that can lead to more serious conditions. People who have gluten intolerance (including coeliacs and dermatitis herpetiformis sufferer..
Gluteome
redirect [[Template:Not verified]]The term gluteome is used to describe the entire set of all gluten-like proteins in grains, which consumption causes occurance of clinical manifestations in celiac patients. These proteins include gliadins and glutenins from wheat, secalins from rye, hordeins from b..
Gluteomics
redirect [[Template:Not verified]]The word gluteomics describes the systematic study on the T cell stimulatory peptides in celiac disease. These peptides are derived from gluten or gluten-like proteins. Usually the term gluteomics is used in the context of global approach to identify, target or dete..
Glutethimide
Glutethimide is a hypnotic sedative that was introduced in 1954 as a safe alternative to barbiturates to treat insomnia. Before long, however, it had become clear that glutethimide was just as likely to cause addiction and caused similarly severe withdrawal symptoms. It was originally a in the Uni..
Gluteus maximus muscle
The gluteus maximus is the largest and most superficial of the three gluteal muscles. In Gray's Anatomy, it is considered a part of the thigh muscle group. It makes up a large portion of the shape and appearance of the buttocks. It is a broad and thick fleshy mass of a quadrilateral shape, and f..
Gluteus medius muscle
The gluteus medius, one of the three gluteal muscles, is a broad, thick, radiating muscle, situated on the outer surface of the pelvis. Its posterior third is covered by the gluteus maximus, its anterior two-thirds by the gluteal aponeurosis, which separates it from the superficial fascia and int..
Gluteus minimus muscle
The gluteus minimus, the smallest of the three gluteal muscles, is placed immediately beneath the gluteus maximus. It is fan-shaped, arising from the outer surface of the ilium, between the anterior and inferior gluteal lines, and behind, from the margin of the greater sciatic notch. The fibers..
Glutinous rice
Glutinous rice (also called sticky rice, sweet rice, waxy rice, botan rice, mochi rice, and pearl rice) is the main type of rice grown and consumed by the Lao of Laos and Northeast Thailand, areas which are considered to be the primary center of origin and domestication of Asian rice (Oryza sativa L..
Gluttony
"Glutton" redirects here. For , see wolverine. "Gluttony" can also refer to a character named "Gluttony" - a homonculus from the anime series Full Metal Alchemist. Gluttony is the over-indulgence and over-consumption of food, drink, or intoxicants to the point of waste. In the Christian religions, i..
Glutton Bowl
The Glutton Bowl was a two-hour Fox Network eating special in 2002 sanctioned by the International Federation of Competitive Eating. The special, which was co-executive produced by Nash Entertainment and IFOCE co-founder Richard Shea, featured Mark Thompson and IFOCE co-founder George Shea as hosts..
Gluvian, St. Columb
Gluvian is a hamlet, in the parish of St. Columb Major ..
Gluyas Williams
Gluyas Williams (July 23, 1888 – February 13, 1982) was an American cartoonist. He was born in San Francisco, California and graduated from Harvard in 1911. His cartoons employed a clear black and white style and often dealt with prevailing themes of the day such as Prohibition. His work appe..
From Wikipedia, the Free Encyclopedia. Article contents subject to the GNU Free Documentation License.