Opentopia Directory Encyclopedia Tools

Corticotropin-releasing hormone

Encyclopedia : C : CO : COR : Corticotropin-releasing hormone



 

|- | align="center" colspan="2" |
|- | colspan="2" bgcolor="#dddddd" | Identifiers |- | bgcolor="#e7dcc3" | Symbol(s) | bgcolor="#eeeeee" | [CRH] |- | bgcolor="#e7dcc3" | Entrez | bgcolor="#eeeeee" | [1392] |- class="hiddenStructure" | bgcolor="#e7dcc3" | OMIM | bgcolor="#eeeeee" | [122560] |- | bgcolor="#e7dcc3" | RefSeq | bgcolor="#eeeeee" | [NM_000756] |- | bgcolor="#e7dcc3" | UniProt | bgcolor="#eeeeee" | [P06850] |- class="hiddenStructure" | bgcolor="#e7dcc3" | PDB | bgcolor="#eeeeee" | [] |- | colspan="2" bgcolor="#dddddd" | Other data |- class="hiddenStructure" | bgcolor="#e7dcc3" | EC number | bgcolor="#eeeeee" | [] |- | bgcolor="#e7dcc3" | Locus | bgcolor="#eeeeee" | Chr. 8[q13] |- |}

Corticotropin-releasing hormone (CRH), originally named corticotropin-releasing factor (CRF), and also called corticoliberin, is a polypeptide hormone and neurotransmitter involved in the stress response.

Hormonal actions

CRH is produced by neuroendocrine cells in the paraventricular nucleus of the hypothalamus and is released from neurosecretory terminals of these neurons into the primary capillary plexus of the hypothalamo-hypophyseal portal system. The portal system carries the CRH to the anterior lobe of the pituitary, where it stimulates corticotropes to secrete corticotropin (ACTH) and other biologically active substances (for example β-endorphin).

Neurotransmitter actions

CRH receptors are also present at many different sites in the brain, and CRH released from nerve endings within the brain acts as a neurotransmitter. For example, CRH receptors are found within the paraventricular nucleus itself, the central nucleus of the amygdala, the bed nucleus of the stria terminalis, and at the locus coeruleus.

Role in parturition

CRH is also synthesized by the placenta and seems to determine the duration of pregnancy.

Structure

The 41-amino acid sequence of CRH was first determined by Shibahara et al in 1983. Its full sequence is

SEEPPISLDLTFHLLREVLEMARAEQLAQQAHSNRKLMEII

See also

Reference

Hormones and endocrine glands - [edit]

Hypothalamus: GnRH - TRH - CRH - GHRH - somatostatin - dopamine | Posterior pituitary: vasopressin - oxytocin | Anterior pituitary: GH - ACTH - TSH - LH - FSH - prolactin - MSH - endorphins - lipotropin

Thyroid: T3 and T4 - calcitonin | Parathyroid: PTH | Adrenal medulla: epinephrine - norepinephrine | Adrenal cortex: aldosterone - cortisol - DHEA | Pancreas: glucagon- insulin - somatostatin | Ovary: estradiol - progesterone - inhibin - activin | Testis: testosterone - AMH - inhibin | Pineal gland: melatonin | Kidney: renin - EPO - calcitriol - prostaglandin | Heart atrium: ANP

Stomach: gastrin | Duodenum: CCK - GIP - secretin - motilin - VIP | Ileum: enteroglucagon | Liver: IGF-1

Placenta: hCG - HPL - estrogen - progesterone

Adipose tissue: leptin

 


From Wikipedia, the Free Encyclopedia. Original article here. Support Wikipedia by contributing or donating.
All text is available under the terms of the GNU Free Documentation License See Wikipedia Copyrights for details.


Search Titles
0123456789
ABCDEFGHIJ
KLMNOPQRST
UVWXYZ?

E-mail this article to:

Personal Message: